PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03540.1.g00050.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 397aa    MW: 42376.9 Da    PI: 7.529
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03540.1.g00050.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.81.3e-09256314563
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                   kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  ++ l +++
  Zpz_sc03540.1.g00050.1.am.mk 256 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSSGLATQN 314
                                   999******************************************99998887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-16252316IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.714254317IPR004827Basic-leucine zipper domain
PfamPF001703.6E-9256314IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-10256313No hitNo description
SuperFamilySSF579591.62E-10256306No hitNo description
CDDcd147033.14E-23257306No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MNGAANGHGL VPHHHHHHPA QASAPFAAQH QGSGGGRQLA GLPPTPPGSH AAHADVCMDD  60
ASAARAQAQG GGGLPPRKAH RRSRSDVPFG YFQPPSPKTE ASGGGWGLPV SGGGGDDLFN  120
AYMSMDGVDA GLRYGSDGDS LGSSMRTNGA DSSENESEDY GGGADSQFLV WGDAAGKKSR  180
EGGKRNGARE PAAAPAGRGH ARSLSMDSLI GKLSFSANGE PSKFSLDFGG GEFTPAEMKR  240
IMADEKLAEM ALADPKRVKR VLANRQSAAR SKERRMRYIA ELEQKVQILQ TEATTLSAQL  300
TLLQRDSSGL ATQNNELKFR LQAMEQQAQL RDALNEALTA EVQRLKVGDA SSSSNLPQQM  360
QLHCQSQMQE LHKQQQGEQI PFYQLEQREV ARNHEAK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698006.10.0PREDICTED: transcription factor RF2b-like
TrEMBLA0A0E0MA281e-175A0A0E0MA28_ORYPU; Uncharacterized protein
STRINGSi039566m1e-173(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.33e-60bZIP family protein